PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4AS_E20BDE652.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 383aa    MW: 39721.1 Da    PI: 9.5317
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4AS_E20BDE652.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.61.4e-3887147262
                 zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                            +e alkcprCdstntkfCyynnyslsqPr+fCkaCrryWt+GGalr vPvGgg+r+nk+ss
  Traes_4AS_E20BDE652.1  87 PEPALKCPRCDSTNTKFCYYNNYSLSQPRHFCKACRRYWTRGGALRSVPVGGGCRRNKRSS 147
                            67899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3371136IPR003851Zinc finger, Dof-type
PfamPF027019.0E-3390145IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.55391145IPR003851Zinc finger, Dof-type
PROSITE patternPS01361093129IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MVFPPAAAYL DPPNWNNQQG QQQRATGGGG VGDAQHMPVD PTAGTAAGTP EVGGLPRSSA  60
ANEAAAGQQA RPNSMTERAR MARVPQPEPA LKCPRCDSTN TKFCYYNNYS LSQPRHFCKA  120
CRRYWTRGGA LRSVPVGGGC RRNKRSSKSS AGAASSSKPS SSSARQLPGG ASSMPSTAAS  180
TTLGCDGASI PPGLSSMSHH LPFMGAMHPP GANLGLAFSA GLPQLAMQQH HHHMDGVDQF  240
PLASGGGATF GASLEQWRVQ QQQQQQFPFL ELPPAPPMYQ LGLQANRAAG SSAAAPAPSP  300
AMFTLGQSSA STARRDEGSM KQADSKGQEM TLQRQFVMEA LRQGDGVWGG NASDNNGNGS  360
GSWTMNIPGF HSSSGGGDGG GLL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3758440.0AK375844.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3107J22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629100.11e-130PREDICTED: dof zinc finger protein DOF3.6-like isoform X1
TrEMBLW5E0C70.0W5E0C7_WHEAT; Uncharacterized protein
STRINGMLOC_57297.30.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123012432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.15e-36Dof family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]